Recombinant Protein

3-7 工作日

CLEC4C

Blood dendritic cell antigen 2 ;BDCA-2;C-type lectin superfamily member 7Dendritic lectin; CD303

Homo sapiens (Human)

Extracellular Domain

36.0 kDa

N-terminal 6xHis-SUMO-tagged

E.coli

Greater than 90% as determined by SDS-PAGE.

Tris-based buffer，50% glycerol

Measured by its binding ability in a functional ELISA. Immobilized CLEC4C protein at 1 μg/ml can bind human IgG, the EC50 of human IgG is 31.43-43.52 μg/ml.

Molecular and genomic characterization of human DLEC, a novel member of the C-type lectin receptor gene family preferentially expressed on monocyte-derived dendritic cells.Arce I., Roda-Navarro P., Montoya M.C., Hernanz-Falcon P., Puig-Kroger A., Fernandez-Ruiz E.3.0.CO;2-X>Eur. J. Immunol. 31:2733-2740(2001)

NFMYSKTVKRLSKLREYQQYHPSLTCVMEGKDIEDWSCCPTPWTSFQSSCYFISTGMQSWTKSQKNCSVM
GADLVVINTREEQDFIIQNLKRNSSYFLGLSDPGGRRHWQWVDQTPYNENVTFWHSGEPNNLDERCAIIN
FRSSEEWGWNDIHCHVPQKSICKMKKIYI

Involved in antigen-capturing. Target ligand into antigen processing and peptide-loading compartments for presentation to T-cells. May mediate potent inhibition of induction of IFN-alpha/beta expression in plasmacytoid dendritic cells. May act as a signaling receptor that activates protein-tyrosine kinases and mobilizes intracellular calcium. Does not se to bind mannose.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

45-213aa

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Immunology