Recombinant Protein

AQP1

Aquaporin-CHIP Urine water channel Water channel protein for red blood cells and kidney proximal tubule

Homo sapiens (Human)

Full Length of Mature Protein

44.4 kDa

N-terminal 6xHis-SUMO-tagged

in vitro E.coli expression system

Greater than 90% as determined by SDS-PAGE.

Tris-based buffer，50% glycerol

Measured by its binding ability in a functional ELISA. Immobilized AQP1 at 2 μg/ml can bind human RGS17, the EC50 of human RGS17 protein is 31.63-34.44 μg/ml.

"Characterization of the 3' UTR sequence encoded by the AQP-1 gene in human retinal pigment epithelium."Ruiz A.C., Bok D.Biochim. Biophys. Acta 1282:174-178(1996)

ASEFKKKLFWRAVVAEFLATTLFVFISIGSALGFKYPVGNNQTAVQDNVKVSLAFGLSIATLAQSVGHIS
GAHLNPAVTLGLLLSCQISIFRALMYIIAQCVGAIVATAILSGITSSLTGNSLGRNDLADGVNSGQGLGI
EIIGTLQLVLCVLATTDRRRRDLGGSAPLAIGLSVALGHLLAIDYTGCGINPARSFGSAVITHNFSNHWI
FWVGPFIGGALAVLIYDFILAPRSSDLTDRVKVWTSGQVEEYDLDADDINSRVEMKPK

Forms a water-specific channel that provides the plasma membranes of red cells and kidney proximal tubules with high permeability to water, thereby permitting water to move in the direction of an osmotic gradient.

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

2-269aa

Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Signal Transduction